Acbd6 Peptide - middle region
Acbd6 Peptide - middle region
Product Specifications
UniProt
Q5RJK8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Acbd6 Rabbit Polyclonal Antibody (orb584665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001011906
Preservative
Lyophilized powder
AA Sequence
SEKKGKEGSSGFGGPVVSSLYHEETIREEDKNIFDYCRENNIDHITKAIK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
034030-PE 200 µL
CMTM5, ID (CMTM5, CKLFSF5, CKLF-like MARVEL transmembrane domain-containing protein 5, Chemokine-like factor superfamily member 5) (PE) discontinued
Sign In for Pricing
View Details AM3765 2 OD, 4 OD, 50 OD
MIRacle™ mmu-miR-5098 miRNA Agomir/Antagomir
Sign In for Pricing
View Details 
ARP32751_T100-Biotin 100 µL
CGI-62 Antibody - C-terminal region : Biotin (ARP32751_T100-Biotin)
Sign In for Pricing
View Details 
MBS6177359-01 0.1 mL
TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (FITC)
Sign In for Pricing
View Details