Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf3 Peptide - N-terminal region

Klf3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9930027G08Rik, AL024007, Bklf, Tef-2

UniProt

Q60980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klf3 Rabbit Polyclonal Antibody (orb577031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032479

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Okadaic acid
SIH-521-20UG 20 µg

Okadaic acid

Sign In for Pricing
View Details
Mcam Mouse Gene Knockout Kit (CRISPR)
KN309859RB 1 Kit

Mcam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant FKBP6 Antibody
RC-5716-01 50 μL

Recombinant FKBP6 Antibody

Sign In for Pricing
View Details
Recombinant FKBP6 Antibody
RC-5716-02 100 µL

Recombinant FKBP6 Antibody

Sign In for Pricing
View Details
Recombinant FKBP6 Antibody
RC-5716-03 1 mL

Recombinant FKBP6 Antibody

Sign In for Pricing
View Details
4933411K16Rik Mouse Gene Knockout Kit (CRISPR)
KN500444 1 Kit

4933411K16Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details