Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mrpl22 Peptide - C-terminal region

Mrpl22 Peptide - C-terminal region

Product Specifications

Product Name Alternative

E030011D16Rik, HSPC158, MRP-L25, Rpml25

UniProt

Q8BU88

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mrpl22 Rabbit Polyclonal Antibody (orb585448) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778166

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQIIKEVLLEAQDMAVRDHNVEFRSNLHIAESTSGRGQCLKRIRYHGRGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raf inhibitor 2
HY-109574-01 5 mg

Raf inhibitor 2

Sign In for Pricing
View Details
Raf inhibitor 2
HY-109574-02 10 mM - 1 mL

Raf inhibitor 2

Sign In for Pricing
View Details
Raf inhibitor 2
HY-109574-03 10 mg

Raf inhibitor 2

Sign In for Pricing
View Details
Raf inhibitor 2
HY-109574-04 25 mg

Raf inhibitor 2

Sign In for Pricing
View Details
Raf inhibitor 2
HY-109574-05 50 mg

Raf inhibitor 2

Sign In for Pricing
View Details
KIF13A Blocking Peptide
MBS9632328-01 1 mg

KIF13A Blocking Peptide

Sign In for Pricing
View Details