Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nus1 Peptide - middle region

Nus1 Peptide - middle region

Product Specifications

Product Name Alternative

1600027K07Rik, AU019165, AW538011, BC003223, D10Ertd438e

UniProt

Q99LJ8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nus1 Rabbit Polyclonal Antibody (orb326620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_084526

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLMDEILKQQQELLGQDCSKYSAEFANSNDKDDQDLNCPSAVKVLSPEDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mob2 Protein Lysate (Human) with C-Ha Tag
30279031 100 µg

Mob2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
C20orf4 Polyclonal Antibody, PE Conjugated
bs-15111R-PE 100 µL

C20orf4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Tetrahydrofuran, anhydrous, 99.9%, unstabilised
GK8887-500ml 500 mL

Tetrahydrofuran, anhydrous, 99.9%, unstabilised

Sign In for Pricing
View Details
Dlk1 ORF Vector (Mouse) (pORF)
18288014 1.0 µg DNA

Dlk1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
P7C3
SIH-571-5MG 5 mg

P7C3

Sign In for Pricing
View Details
Ocrl 3'UTR Luciferase Stable Cell Line
TU114510 1.0 mL

Ocrl 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details