Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR10J3 Peptide - C-terminal region

OR10J3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR1-25, OR10J3P

UniProt

Q5JRS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR10J3 Rabbit Polyclonal Antibody (orb587319) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004467

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLTVVIIHYGCASIIYLKPKSQSSLGQDRLISVTYTHHSPTEPCCVQPEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-[(2-hydroxyethyl)amino]propanenitrile
TRC-B444133-5MG 5 mg

3-[(2-hydroxyethyl)amino]propanenitrile

Sign In for Pricing
View Details
Triethylsilane
TRC-T777400-50G 50 g

Triethylsilane

Sign In for Pricing
View Details
Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)
PDER100231-01 20 µg

Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)
PDER100231-02 100 µg

Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)
PDER100231-03 500 µg

Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)
PDER100231-04 1 mg

Recombinant Rat IGFBP1/IGFBP-1 protein (His tag)

Sign In for Pricing
View Details