Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aste1 Peptide - C-terminal region

Aste1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1100001A21Rik, AV006403

UniProt

Q8BIR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aste1 Rabbit Polyclonal Antibody (orb576283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079927

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit
MBS7618913-01 48 Well

Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit
MBS7618913-02 96 Well

Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit
MBS7618913-03 5x 96 Well

Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit
MBS7618913-04 10x 96 Well

Human HYOU1 (Hypoxia Up Regulated 1) QuickTest ELISA Kit

Sign In for Pricing
View Details
TRAM2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2440304 1.0 µg DNA

TRAM2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
RPL12 Peptide - N-terminal region
orb2009155 100 µg

RPL12 Peptide - N-terminal region

Sign In for Pricing
View Details