Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL12 Peptide - N-terminal region

RPL12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L12

UniProt

P30050

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL12 Rabbit Polyclonal Antibody (orb585098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000967

Preservative

Lyophilized powder

AA Sequence

ATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Growth Arrest-Specific Protein 1 ELISA Kit
MBS7258753-01 48 Well

Goat Growth Arrest-Specific Protein 1 ELISA Kit

Sign In for Pricing
View Details
Goat Growth Arrest-Specific Protein 1 ELISA Kit
MBS7258753-02 96 Well

Goat Growth Arrest-Specific Protein 1 ELISA Kit

Sign In for Pricing
View Details
Goat Growth Arrest-Specific Protein 1 ELISA Kit
MBS7258753-03 5x 96 Well

Goat Growth Arrest-Specific Protein 1 ELISA Kit

Sign In for Pricing
View Details
Goat Growth Arrest-Specific Protein 1 ELISA Kit
MBS7258753-04 10x 96 Well

Goat Growth Arrest-Specific Protein 1 ELISA Kit

Sign In for Pricing
View Details
Nalidixic Acid free Acid
114060 25 25 g

Nalidixic Acid free Acid

Sign In for Pricing
View Details
MCT12 Polyclonal Antibody
E44H05235 100 µL

MCT12 Polyclonal Antibody

Sign In for Pricing
View Details