Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC103 Peptide - C-terminal region

CCDC103 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CILD17, PR46b, SMH

UniProt

Q8IW40

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC103 Rabbit Polyclonal Antibody (orb326925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_998772

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNA1 Recombinant Protein (Human)
OPCA03846-1MG 1 mg

EFNA1 Recombinant Protein (Human)

Sign In for Pricing
View Details
CC85C, NT (CCDC85C, Coiled-coil domain-containing protein 85C) (MaxLight 405)
MBS6281326-01 0.1 mL

CC85C, NT (CCDC85C, Coiled-coil domain-containing protein 85C) (MaxLight 405)

Sign In for Pricing
View Details
CC85C, NT (CCDC85C, Coiled-coil domain-containing protein 85C) (MaxLight 405)
MBS6281326-02 5x 0.1 mL

CC85C, NT (CCDC85C, Coiled-coil domain-containing protein 85C) (MaxLight 405)

Sign In for Pricing
View Details
HOS59 Antibody
orb840720 2 mg

HOS59 Antibody

Sign In for Pricing
View Details
MIG9 Antibody / Migration inducing gene 9
orb1823472-01 20 µg

MIG9 Antibody / Migration inducing gene 9

Sign In for Pricing
View Details
MIG9 Antibody / Migration inducing gene 9
orb1823472-02 100 µg

MIG9 Antibody / Migration inducing gene 9

Sign In for Pricing
View Details