Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ephrin A1

Gene Aliases

B61; ECKLG; EFL1; eph-related receptor tyrosine kinase ligand 1; ephrin-A1; epididymis secretory sperm binding protein; EPLG1; gastric cancer metastasis associated long noncoding RNA; GMAN; immediate early response protein B61; LERK1; LERK-1; ligand of eph-related kinase 1; TNF alpha-induced protein 4; TNFAIP4; Tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4.

Gene ID

1942

Accession Number

NP_004419

Reactivity

Homo sapiens|Human

Target

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. Plays an important role in angiogenesis and tumor neovascularization. The recruitment of VAV2, VAV3 and PI3-kinase p85 subunit by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell migration and assembly. Exerts anti-oncogenic effects in tumor cells through activation and down-regulation of EPHA2. Activates EPHA2 by inducing tyrosine phosphorylation which leads to its internalization and degradation. Acts as a negative regulator in the tumorigenesis of gliomas by down-regulating EPHA2 and FAK. Can evoke collapse of embryonic neuronal growth cone and regulates dendritic spine morphogenesis.

Type

Protein

Source

E.coli

Sequence

DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

EFNA1

Protein Name

Ephrin-A1

Gene Name URL

EFNA1

Nucleotide Accession Number

NM_004428

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LAMTOR1 Antibody [DyLight 594]
NBP2-82075DL594 0.1 mL

Rabbit Polyclonal LAMTOR1 Antibody [DyLight 594]

Sign In for Pricing
View Details
Anti-Sarcomeric Alpha Actinin Polyclonal Antibody
TMAB-01653-01 50 μL

Anti-Sarcomeric Alpha Actinin Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Sarcomeric Alpha Actinin Polyclonal Antibody
TMAB-01653-02 100 µL

Anti-Sarcomeric Alpha Actinin Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Sarcomeric Alpha Actinin Polyclonal Antibody
TMAB-01653-03 200 µL

Anti-Sarcomeric Alpha Actinin Polyclonal Antibody

Sign In for Pricing
View Details
ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) (MaxLight 550)
128509-ML550 100 µL

ING3 (Inhibitor of Growth Protein 3, p47ING3, HSPC301, FLJ20089, ING2) (MaxLight 550)

Sign In for Pricing
View Details
ITM2B Recombinant Protein
91-567 0.05 mg

ITM2B Recombinant Protein

Sign In for Pricing
View Details