Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFR3B Peptide - C-terminal region

EFR3B Peptide - C-terminal region

Product Specifications

Product Name Alternative

KIAA0953

UniProt

Q9Y2G0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFR3B Rabbit Polyclonal Antibody (orb587374) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055786

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PQLTDEDRLSKRRSIGETISLQVEVESRNSPEKEERVPAEEITYETLKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant rat Ephrin-A5
OPCA00075-100UG 100 µg

Recombinant rat Ephrin-A5

Sign In for Pricing
View Details
Goat Neurotrophin 4 (NT4) ELISA KIT
MBS269829-01 48 Well

Goat Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
Goat Neurotrophin 4 (NT4) ELISA KIT
MBS269829-02 96 Well

Goat Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
Goat Neurotrophin 4 (NT4) ELISA KIT
MBS269829-03 5x 96 Well

Goat Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
Goat Neurotrophin 4 (NT4) ELISA KIT
MBS269829-04 10x 96 Well

Goat Neurotrophin 4 (NT4) ELISA KIT

Sign In for Pricing
View Details
IL-1alpha ELISA Kit
MBS495297-01 96 Tests

IL-1alpha ELISA Kit

Sign In for Pricing
View Details