Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant rat Ephrin-A5

Product Specifications

CAS Number

9000-83-3

Gene Name

Ephrin A5

Gene Aliases

AL-1; eph-related receptor tyrosine kinase ligand 7; ephrin-A5; Lerk7; LERK-7.

Gene ID

116683

Reactivity

Rat|Rattus norvegicus

Target

Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion (By similarity) .

Type

Protein

Source

E.coli

Sequence

QDPGSKVVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVRDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

25.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Efna5

Protein Name

Ephrin-A5

Gene Name URL

Efna5

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Olfactory receptor 9A4 (OR9A4) ELISA kit
GTR10420177 96 Well

Human Olfactory receptor 9A4 (OR9A4) ELISA kit

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain 33849/DSM 4235/NCIB 12045/K12/DH1) RUTB Polyclonal Antibody
MBS7178915 Inquire

Rabbit anti-Escherichia coli (strain 33849/DSM 4235/NCIB 12045/K12/DH1) RUTB Polyclonal Antibody

Sign In for Pricing
View Details
Tensin-2 Tyr483 Rabbit Polyclonal Antibody
E53P03963 100 µL

Tensin-2 Tyr483 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Chloro-1-phenyldibenzothiophene
JH917128 1 Each

7-Chloro-1-phenyldibenzothiophene

Sign In for Pricing
View Details
NABC1 (BCAS1) CytoSection
TS423329P5 25 Slides

NABC1 (BCAS1) CytoSection

Sign In for Pricing
View Details
FAM90A1 CRISPR/Cas9 KO Plasmid (h)
sc-412456 20 µg

FAM90A1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details