Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gps2 Peptide - N-terminal region

Gps2 Peptide - N-terminal region

Product Specifications

UniProt

Q9WV81

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GPS2 Rabbit Polyclonal Antibody (orb586016) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLNMQGSPGGHN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFKM Protein Vector (Mouse) (pPM-C-HA)
36435025 500 ng

PFKM Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Anti-HIF1AN Antibody
A02116-1 100 µL

Anti-HIF1AN Antibody

Sign In for Pricing
View Details
C17orf100 Human shRNA Plasmid Kit (Locus ID 388327)
TR320174 1 Kit

C17orf100 Human shRNA Plasmid Kit (Locus ID 388327)

Sign In for Pricing
View Details
Polyclonal Antibody to Chikungunya Virus (CHIKV)
MBS2111440-01 0.1 mL

Polyclonal Antibody to Chikungunya Virus (CHIKV)

Sign In for Pricing
View Details
Polyclonal Antibody to Chikungunya Virus (CHIKV)
MBS2111440-02 0.2 mL

Polyclonal Antibody to Chikungunya Virus (CHIKV)

Sign In for Pricing
View Details
Polyclonal Antibody to Chikungunya Virus (CHIKV)
MBS2111440-03 0.5 mL

Polyclonal Antibody to Chikungunya Virus (CHIKV)

Sign In for Pricing
View Details