HDHD3 Peptide - C-terminal region
HDHD3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
2810435D12Rik, C9orf158
UniProt
Q9BSH5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at 2°C. Avoid repeat freezethaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HDHD3 Rabbit Polyclonal Antibody (orb587444) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_112496
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882536-100 1x 100 µL
EZH2 / KMT6 (EZH2/2536), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSH033863-02 100 µg
Recombinant Human CD52 (C-Fc-Avi) Biotinylated
Sign In for Pricing
View Details