BCL11B Peptide - C-terminal region
BCL11B Peptide - C-terminal region
Product Specifications
Product Name Alternative
ATL1, RIT1, CTIP2, CTIP-2, ZNF856B, ATL1-beta, ATL1-alpha, ATL1-delta, ATL1-gamma, hRIT1-alpha
UniProt
Q9C0K0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BCL11B Rabbit Polyclonal Antibody (orb574484) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001269166.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTGSGGSTPHISGPGPGRPSSKEGRRSDTCSSHTPIRRSTQRAQDVWQFS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-A630360-50MG 50 mg
5-Amino-1,3,4-thiadiazole-2-sulfonamide Hydrochloride Salt
Sign In for Pricing
View Details 