Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL30 Peptide - C-terminal region

KLHL30 Peptide - C-terminal region

Product Specifications

UniProt

Q0D2K2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLHL30 Rabbit Polyclonal Antibody (orb587498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940984

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YHVEMEAYDTVRDTWTRHGALPRLWLYHGASTVFLDVSKWTQPSGPTQEH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vilanterol Impurity 15
RM-V091215-01 10 mg

Vilanterol Impurity 15

Sign In for Pricing
View Details
Vilanterol Impurity 15
RM-V091215-02 25 mg

Vilanterol Impurity 15

Sign In for Pricing
View Details
Vilanterol Impurity 15
RM-V091215-03 50 mg

Vilanterol Impurity 15

Sign In for Pricing
View Details
Vilanterol Impurity 15
RM-V091215-04 100 mg

Vilanterol Impurity 15

Sign In for Pricing
View Details
JNK1+JNK2+JNK3 Rabbit Polyclonal Antibody (Cy5.5)
orb1049311 100 µL

JNK1+JNK2+JNK3 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
ARPC1B Antibody - middle region : FITC (ARP65735_P050-FITC)
ARP65735_P050-FITC 100 µL

ARPC1B Antibody - middle region : FITC (ARP65735_P050-FITC)

Sign In for Pricing
View Details