Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGFRL1 Peptide - middle region

FGFRL1 Peptide - middle region

Product Specifications

Product Name Alternative

FHFR, FGFR5

UniProt

Q8N441

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGFRL1 Rabbit Polyclonal Antibody (orb587458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004356.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fabp6-set siRNA/shRNA/RNAi Lentivector (Mouse)
19656094 4x 500 ng

Fabp6-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
MRPL35 CRISPRa sgRNA lentivector (set of three targets)(Human)
30471121 3x 1.0µg DNA

MRPL35 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
SIX5 Blocking Peptide
MBS9624302-01 1 mg

SIX5 Blocking Peptide

Sign In for Pricing
View Details
SIX5 Blocking Peptide
MBS9624302-02 5x 1 mg

SIX5 Blocking Peptide

Sign In for Pricing
View Details
FABP4 Knockout HEK293T Polyclonal Cells
ARG3635 1 Million

FABP4 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Caper (R199) polyclonal antibody
BS1891-01 50 µL

Caper (R199) polyclonal antibody

Sign In for Pricing
View Details