Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS25 Peptide - C-terminal region

MRPS25 Peptide - C-terminal region

Product Specifications

UniProt

E7EPW2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPS25 Rabbit Polyclonal Antibody (orb587546) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YKNPWVQIMMFKNMTPSPFLRFYLDSGEQVLVDVETKSNKEIMEHIRKIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-IL-12B Antibody (Detection)
CAP1076-D-01 100 µg

Anti-IL-12B Antibody (Detection)

Sign In for Pricing
View Details
Anti-IL-12B Antibody (Detection)
CAP1076-D-02 1 mg

Anti-IL-12B Antibody (Detection)

Sign In for Pricing
View Details
Platycoside M3
MBS5762965 Inquire

Platycoside M3

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SHH (Sonic hedgehog signaling molecule) for Antibody Discovery
MP1259J Each

Magic™ Membrane Protein Human SHH (Sonic hedgehog signaling molecule) for Antibody Discovery

Sign In for Pricing
View Details
Phospho-MAX (Ser11) Peptide
AF8034-BP 1 mg

Phospho-MAX (Ser11) Peptide

Sign In for Pricing
View Details
Thrombomodulin Antibody (N-Terminal Region)
F54085-0.2ML 0.2 mL

Thrombomodulin Antibody (N-Terminal Region)

Sign In for Pricing
View Details