Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEC31B Peptide - middle region

SEC31B Peptide - middle region

Product Specifications

Product Name Alternative

SEC31B-1, SEC31L2

UniProt

Q9NQW1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SEC31B Rabbit Polyclonal Antibody (orb586574) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056305

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASASSAFFDELVPQNMT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Homeobox protein SIX2 Six2 Antibody
A04092 100 µL

Anti-Homeobox protein SIX2 Six2 Antibody

Sign In for Pricing
View Details
Lentiviral human RAB30 shRNA (UAS) - Lentiviral human RAB30 shRNA (UAS) plasmid
GTR15306742 1 Vial

Lentiviral human RAB30 shRNA (UAS) - Lentiviral human RAB30 shRNA (UAS) plasmid

Sign In for Pricing
View Details
WAY-181187 (oxalate)
HY-110366 1 Each

WAY-181187 (oxalate)

Sign In for Pricing
View Details
PDE4C, NT (PDE4C, DPDE1, cAMP-specific 3',5'-cyclic phosphodiesterase 4C, PDE21) (MaxLight 750)
MBS6332153-01 0.1 mL

PDE4C, NT (PDE4C, DPDE1, cAMP-specific 3',5'-cyclic phosphodiesterase 4C, PDE21) (MaxLight 750)

Sign In for Pricing
View Details
PDE4C, NT (PDE4C, DPDE1, cAMP-specific 3',5'-cyclic phosphodiesterase 4C, PDE21) (MaxLight 750)
MBS6332153-02 5x 0.1 mL

PDE4C, NT (PDE4C, DPDE1, cAMP-specific 3',5'-cyclic phosphodiesterase 4C, PDE21) (MaxLight 750)

Sign In for Pricing
View Details
N-[4- (4-Amino-2-ethyl-1H-imidazo[4,5-c]quinolin-1-yl) butyl]-methylesulfonamide
NA162905-01 25 mg

N-[4- (4-Amino-2-ethyl-1H-imidazo[4,5-c]quinolin-1-yl) butyl]-methylesulfonamide

Sign In for Pricing
View Details