Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMF1 Peptide - N-terminal region

LMF1 Peptide - N-terminal region

Product Specifications

UniProt

H3BVI4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LMF1 Rabbit Polyclonal Antibody (orb580846) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDIRGARPEPRFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Oxidized Low Density Lipoprotein Antibody OLAb ELISA Kit
BG-HUM11607 1 Each

Human Anti-Oxidized Low Density Lipoprotein Antibody OLAb ELISA Kit

Sign In for Pricing
View Details
Human Calpain 6 (CAPN6) ELISA Kit
DL-CAPN6-Hu-01 48 Tests

Human Calpain 6 (CAPN6) ELISA Kit

Sign In for Pricing
View Details
Human Calpain 6 (CAPN6) ELISA Kit
DL-CAPN6-Hu-02 96 Tests

Human Calpain 6 (CAPN6) ELISA Kit

Sign In for Pricing
View Details
EIF5A Peptide - C-terminal region
orb2002599 100 µg

EIF5A Peptide - C-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal IRF1 Antibody
NBP1-78762 100 µL

Rabbit Polyclonal IRF1 Antibody

Sign In for Pricing
View Details
Recombinant Clostridium Kluyveri rpsL Protein (aa 1-125)
VAng-Lsx9797-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri rpsL Protein (aa 1-125)

Sign In for Pricing
View Details