Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF5A Peptide - C-terminal region

EIF5A Peptide - C-terminal region

Product Specifications

Product Name Alternative

EIF-5A, EIF5A1, eIF5AI

UniProt

P63241

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF5A Rabbit Polyclonal Antibody (orb327237) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLQDSGEVREDLRLPEGDLGKEIEQKYDCGEEILITVLSAMTEEAAVAIK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5C1B CytoSection
TS431342P5 25 Slides

NT5C1B CytoSection

Sign In for Pricing
View Details
Emc2 (NM_025736) Mouse Tagged ORF Clone
MR204127 10 µg

Emc2 (NM_025736) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ALKBH8 3'UTR Lenti-reporter-Luc Vector
11779081 1.0 µg

ALKBH8 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
(Pyr16) -VIP (16-28) (human, bovine, porcine, rat)
M40487-01 100 mg

(Pyr16) -VIP (16-28) (human, bovine, porcine, rat)

Sign In for Pricing
View Details
(Pyr16) -VIP (16-28) (human, bovine, porcine, rat)
M40487-02 25 mg

(Pyr16) -VIP (16-28) (human, bovine, porcine, rat)

Sign In for Pricing
View Details
(Pyr16) -VIP (16-28) (human, bovine, porcine, rat)
M40487-03 50 mg

(Pyr16) -VIP (16-28) (human, bovine, porcine, rat)

Sign In for Pricing
View Details