PPP1R18 Peptide - C-terminal region
PPP1R18 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HKMT1098, KIAA1949
UniProt
Q6NYC8
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R18 Rabbit Polyclonal Antibody (orb325753) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_597728
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEDAGTGGLRQQEEEAVELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2231-500 1x 500 µL
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), 0.2mg/mL
Sign In for Pricing
View Details ![LUZP4 Mouse Monoclonal Antibody [Clone ID: OTI3A5]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9084c1/imageurl/cf809086.webp)
LC401409 20 µg
Ephrin B1 (EFNB1) (NM_004429) Human Over-expression Lysate
Sign In for Pricing
View Details 
