KIR2DL3 Peptide - middle region
KIR2DL3 Peptide - middle region
Product Specifications
UniProt
P43628
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIR2DL3 Rabbit Polyclonal Antibody (orb586384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PTH1R Recombinant Rabbit Monoclonal Antibody [JE36-10]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea8125d/imageurl/ha721716.webp)
HA721716 100 µL
PTH1R Recombinant Rabbit Monoclonal Antibody [JE36-10]
Sign In for Pricing
View Details 
