PTCD2 Peptide - N-terminal region
PTCD2 Peptide - N-terminal region
Product Specifications
UniProt
Q8WV60
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTCD2 Rabbit Polyclonal Antibody (orb586889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_079030
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2905989-01 20 µg
Recombinant Human Olfactory receptor 6K2 (OR6K2)
Sign In for Pricing
View Details orb2905989-02 100 µg
Recombinant Human Olfactory receptor 6K2 (OR6K2)
Sign In for Pricing
View Details 
TRV-0042173-01 20 µL
Polyclonal Antibody to Minichromosome Maintenance Deficient 3 (MCM3)
Sign In for Pricing
View Details