Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 6K2 (OR6K2)

This Recombinant Human Olfactory receptor 6K2 (OR6K2) spans the amino acid sequence from region 1-324.

Product Specifications

Product Name Alternative

Olfactory receptor 6K2, Olfactory receptor OR1-17

UniProt

Q8NGY2

Expression Region

1-324

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESPNRTTIQEFIFSAFPYSWVKSVVCFVPLLFIYAFIVVGNLVIITVVQLNTHLHTPMY TFISALSFLEIWYTTATIPKMLSSLLSERSISFNGCLLQMYFFHSTGICEVCLLTVMAFD HYLAICSPLHYPSIMTPKLCTQLTLSCCVCGFITPLPEIAWISTLPFCGSNHLEHIFCDF LPVLRLACTDTRAIVMIQVVDVIHAVEIITAVMLIFMSYDGIVAVILRIHSAGGRRTAFS TCVSHFIVFSLFFGSVTLMYLRFSATYSLFWDIAIALAFAVLSPFFNPIIYSLRNKEIKE AIKKHIGQAKIFFSVRPGTSSKIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH3A1 (NM_001135168) Human Recombinant Protein
TP325751L 1 mg

ALDH3A1 (NM_001135168) Human Recombinant Protein

Sign In for Pricing
View Details
SYCE3 Rabbit Polyclonal Antibody
TA365263 100 µL

SYCE3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (2F6), CF647 conjugate, 0.1mg/mL
BNC471014-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (2F6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GNL1 Human Gene Knockout Kit (CRISPR)
KN402266 1 Kit

GNL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spinosyn D
TRC-S681955-2.5MG 2.5 mg

Spinosyn D

Sign In for Pricing
View Details
Human Frataxin (FXN) activation kit by CRISPRa
GA101655 1 Kit

Human Frataxin (FXN) activation kit by CRISPRa

Sign In for Pricing
View Details