Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tns3 Peptide - C-terminal region

Tns3 Peptide - C-terminal region

Product Specifications

UniProt

Q5SSZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tns3 Rabbit Polyclonal Antibody (orb326624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PHOX2B Polyclonal Antibody
RD86889A-01 60 μL

PHOX2B Polyclonal Antibody

Sign In for Pricing
View Details
PHOX2B Polyclonal Antibody
RD86889A-02 120 μL

PHOX2B Polyclonal Antibody

Sign In for Pricing
View Details
PHOX2B Polyclonal Antibody
RD86889A-03 200 µL

PHOX2B Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Semaphorin 6A Antibody (001) [Alexa Fluor 647]
NBP2-89833AF647 0.1 mL

Rabbit Monoclonal Semaphorin 6A Antibody (001) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human Olfactory receptor 5K1, OR5K1 ELISA KIT
ELI-35183h 96 Tests

Human Olfactory receptor 5K1, OR5K1 ELISA KIT

Sign In for Pricing
View Details
Hamster Interleukin 29 ELISA Kit
MBS018342-01 48 Well

Hamster Interleukin 29 ELISA Kit

Sign In for Pricing
View Details