Tmprss9 Peptide - N-terminal region
Tmprss9 Peptide - N-terminal region
Product Specifications
UniProt
Q0X0F2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMPRSS9 Rabbit Polyclonal Antibody (orb326692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFLSTQGFHVDHTAELRGIRWTSSLRRETSDYHRTLTPTLEALFVSSFQK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AN300365L-01 20 µL
Recombinant Phospho-ERK1/2 (Thr202, Tyr204) Monoclonal Antibody
Sign In for Pricing
View Details AN300365L-02 100 µL
Recombinant Phospho-ERK1/2 (Thr202, Tyr204) Monoclonal Antibody
Sign In for Pricing
View Details 
BNC041129-100 1x 100 µL
MHC II (HLA-DP) (beta chain) (Bra-14), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details