Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDNK Peptide - middle region

IDNK Peptide - middle region

Product Specifications

UniProt

Q5T6J7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IDNK Rabbit Polyclonal Antibody (orb326715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bax inhibitor 1 (TMBIM6) (NM_003217) Human Tagged ORF Clone Lentiviral Particle
RC206916L2V 200 µL

Bax inhibitor 1 (TMBIM6) (NM_003217) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dcdc5 3'UTR Lenti-reporter-Luc Vector
17724084 1.0 µg

Dcdc5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Grasp Peptide - N-terminal region
orb2010472 100 µg

Grasp Peptide - N-terminal region

Sign In for Pricing
View Details
Lentiviral human BFSP2 sgRNA gene knockout kit - Lentiviral human BFSP2 sgRNA gene knockout kit (25)
GTR15375735 1 Vial

Lentiviral human BFSP2 sgRNA gene knockout kit - Lentiviral human BFSP2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
KLC2 CytoSection
TS425936P5 25 Slides

KLC2 CytoSection

Sign In for Pricing
View Details
Vcpkmt Mouse siRNA Oligo Duplex (Locus ID 207965)
SR406288 1 Kit

Vcpkmt Mouse siRNA Oligo Duplex (Locus ID 207965)

Sign In for Pricing
View Details