Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grasp Peptide - N-terminal region

Grasp Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tamalin

UniProt

Q9JJA9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grasp Rabbit Polyclonal Antibody (orb582064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062391

Preservative

Lyophilized powder

AA Sequence

FRWKNFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGLHHREEQRVEMVTFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Methylcyclohex-3-ene-1-carboxylic acid
283040-01 250 mg

4-Methylcyclohex-3-ene-1-carboxylic acid

Sign In for Pricing
View Details
4-Methylcyclohex-3-ene-1-carboxylic acid
283040-02 500 mg

4-Methylcyclohex-3-ene-1-carboxylic acid

Sign In for Pricing
View Details
4-Methylcyclohex-3-ene-1-carboxylic acid
283040-03 1 g

4-Methylcyclohex-3-ene-1-carboxylic acid

Sign In for Pricing
View Details
4-Methylcyclohex-3-ene-1-carboxylic acid
283040-04 2 g

4-Methylcyclohex-3-ene-1-carboxylic acid

Sign In for Pricing
View Details
4-Methylcyclohex-3-ene-1-carboxylic acid
283040-05 5 g

4-Methylcyclohex-3-ene-1-carboxylic acid

Sign In for Pricing
View Details
CD45R (Leukocyte Common Antigen, LCA, Ly-5 T200) (Biotin)
MBS6248693-01 0.1 mL

CD45R (Leukocyte Common Antigen, LCA, Ly-5 T200) (Biotin)

Sign In for Pricing
View Details