Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ift74 Peptide - middle region

Ift74 Peptide - middle region

Product Specifications

Product Name Alternative

Ccdc2

UniProt

Q5XIR2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ift74 Rabbit Polyclonal Antibody (orb331165) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007002

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NMSPEKQVKYIEMKTTNEKLLQELDTLQQQLDSLNIKKESLETEIAHSQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krtap3 (Krtap3-1) (NM_023511) Mouse Tagged ORF Clone Lentiviral Particle
MR216037L4V 200 µL

Krtap3 (Krtap3-1) (NM_023511) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Bax Antibody [SPM336]
34-157 100 µg

Bax Antibody [SPM336]

Sign In for Pricing
View Details
L-Galactose
164651 25 mg

L-Galactose

Sign In for Pricing
View Details
Mouse LPA (Lysophosphatidic Acid) ELISA Kit
EK248002 96 Well

Mouse LPA (Lysophosphatidic Acid) ELISA Kit

Sign In for Pricing
View Details
RAB17 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E2]
TA501239BM 100 µL

RAB17 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5E2]

Sign In for Pricing
View Details
VWDE (m) -PR
sc-145559-PR 10 µM - 20 µL

VWDE (m) -PR

Sign In for Pricing
View Details