Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Irf5 Peptide - middle region

Irf5 Peptide - middle region

Product Specifications

UniProt

B2CC69

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRF5 Rabbit Polyclonal Antibody (orb329911) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GRAPRTLTISNPQGCRLFYSQLEATQEQVELFGPVTLEQVRFPSPEDIPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ixazomib Impurity D
RM-I242604-01 10 mg

Ixazomib Impurity D

Sign In for Pricing
View Details
Ixazomib Impurity D
RM-I242604-02 25 mg

Ixazomib Impurity D

Sign In for Pricing
View Details
Ixazomib Impurity D
RM-I242604-03 50 mg

Ixazomib Impurity D

Sign In for Pricing
View Details
Ixazomib Impurity D
RM-I242604-04 100 mg

Ixazomib Impurity D

Sign In for Pricing
View Details
Cytomegalovirus Antibody / CMV-p65
V5835-100UG 100 µg

Cytomegalovirus Antibody / CMV-p65

Sign In for Pricing
View Details
ELOVL2, NT (ELOVL2, SSC2, Elongation of very long chain fatty acids protein 2, 3-keto acyl-CoA synthase ELOVL2, ELOVL fatty acid elongase 2) (FITC)
MBS6295361-01 0.2 mL

ELOVL2, NT (ELOVL2, SSC2, Elongation of very long chain fatty acids protein 2, 3-keto acyl-CoA synthase ELOVL2, ELOVL fatty acid elongase 2) (FITC)

Sign In for Pricing
View Details