DIS3 Peptide - N-terminal region
DIS3 Peptide - N-terminal region
Product Specifications
UniProt
F2Z2C0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DIS3 Rabbit Polyclonal Antibody (orb577776) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K5020806 1.0 µg DNA
Cngb3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details 
NBP2-50049DL594 0.1 mL
Mouse Monoclonal Aurora A/B Antibody (5A12) [DyLight 594]
Sign In for Pricing
View Details 