Rapgef2 Peptide - C-terminal region
Rapgef2 Peptide - C-terminal region
Product Specifications
UniProt
Q8CHG7
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RAPGEF2 Rabbit Polyclonal Antibody (orb578594) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
131341-ML650 100 µL
PIK3CA (Phosphatidylinositol-4,5-bisphosphate 3-kinase Catalytic Subunit alpha Isoform, PtdIns-3-kinase Subunit alpha, PI3-kinase Subunit alpha, PI3K-alpha, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110kD Catalytic Subunit alpha, PtdIns-3-kinase Subunit p110-alpha, MGC142161, MGC142163) (MaxLight 650)
Sign In for Pricing
View Details 
057677-01 10 µg
Kinesin Family, Member 5A (KIF5A), Recombinant, Human, His-Tag
Sign In for Pricing
View Details