Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGSH Peptide - C-terminal region

SGSH Peptide - C-terminal region

Product Specifications

UniProt

F5H6A3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGSH Rabbit Polyclonal Antibody (orb580285) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Protein C (MaxLight 550) discontinued
138262-ML550 100 µL

Protein C (MaxLight 550) discontinued

Sign In for Pricing
View Details
CLCN3 Protein Vector (Mouse) (pPM-C-HA)
PV165848 500 ng

CLCN3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
DACH2 Peptide - C-terminal region
orb2004025 100 µg

DACH2 Peptide - C-terminal region

Sign In for Pricing
View Details
AMP Activated Protein Kinase, pan (AMPK) (HRP) discontinued
A1475-06-HRP 100 µL

AMP Activated Protein Kinase, pan (AMPK) (HRP) discontinued

Sign In for Pricing
View Details
ING5
565728-01 50 µg

ING5

Sign In for Pricing
View Details
ING5
565728-02 100 µg

ING5

Sign In for Pricing
View Details