Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DACH2 Peptide - C-terminal region

DACH2 Peptide - C-terminal region

Product Specifications

UniProt

Q96NX9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DACH2 Rabbit Polyclonal Antibody (orb574197) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QALKQATTSDSGLRMLKDTGIPDIEIENNGTPHDSAAMQGGNYYCLEMAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Streptococcus pneumoniae (PE)
138397-PE 100 µL

Streptococcus pneumoniae (PE)

Sign In for Pricing
View Details
PKC Recombinant Antibody, Biotin Conjugated
bsm-62958R-Biotin-TR 20 µL

PKC Recombinant Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Ccdc84 Mouse shRNA Plasmid (Locus ID 382073)
TL512329 1 Kit

Ccdc84 Mouse shRNA Plasmid (Locus ID 382073)

Sign In for Pricing
View Details
Tfpi (NM_017200) Rat Tagged ORF Clone Lentiviral Particle
RR214689L4V 200 µL

Tfpi (NM_017200) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-GSTK1 Antibody
MBS8292181-01 0.03 mL

Anti-GSTK1 Antibody

Sign In for Pricing
View Details
Anti-GSTK1 Antibody
MBS8292181-02 0.05 mL

Anti-GSTK1 Antibody

Sign In for Pricing
View Details