Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETDB1 Peptide - N-terminal region

SETDB1 Peptide - N-terminal region

Product Specifications

UniProt

Q15047

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETDB1 Rabbit Polyclonal Antibody (orb576925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1.1 Mouse Monoclonal Antibody [Clone ID: 76-7-4]
AM08103FC-N 500 µg

CD1.1 Mouse Monoclonal Antibody [Clone ID: 76-7-4]

Sign In for Pricing
View Details
Recombinant Human ST6GALNAC2 Protein (His Tag)
PKSH033078-01 10 µg

Recombinant Human ST6GALNAC2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ST6GALNAC2 Protein (His Tag)
PKSH033078-02 50 µg

Recombinant Human ST6GALNAC2 Protein (His Tag)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD133 Antibody[W6B3C1]
E-AB-F1268M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD133 Antibody[W6B3C1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD133 Antibody[W6B3C1]
E-AB-F1268M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD133 Antibody[W6B3C1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD133 Antibody[W6B3C1]
E-AB-F1268M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD133 Antibody[W6B3C1]

Sign In for Pricing
View Details