Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGCB Peptide - middle region

SGCB Peptide - middle region

Product Specifications

UniProt

Q6IBJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGCB Rabbit Polyclonal Antibody (orb579103) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNC antibody
FNab10178 100 µg

TNC antibody

Sign In for Pricing
View Details
H3FA (HIST1H3A) Rabbit Monoclonal Antibody
TA424244 100 µL

H3FA (HIST1H3A) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Fam149b (NM_001024512) Mouse Tagged Lenti ORF Clone
MR209062L4 10 µg

Fam149b (NM_001024512) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
NEUROD1 Rabbit Polyclonal Antibody (Biotin)
orb457781 100 µL

NEUROD1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
CREB1 (aa96-109) Antibody
orb137115 100 µg

CREB1 (aa96-109) Antibody

Sign In for Pricing
View Details
Eukaryotic Interleukin 19 (IL19)
TRV-0019468-01 10 µg

Eukaryotic Interleukin 19 (IL19)

Sign In for Pricing
View Details