Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11F Peptide - C-terminal region

TMPRSS11F Peptide - C-terminal region

Product Specifications

UniProt

Q6ZWK6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS11F Rabbit Polyclonal Antibody (orb331399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997290

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD6 Rabbit Polyclonal Antibody (Cy7)
orb1082927 100 µL

SMAD6 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Intermediate capsid protein VP6 Antibody, Biotin conjugated
CSB-PA542165LD01ROH-01 50 µg

Intermediate capsid protein VP6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Intermediate capsid protein VP6 Antibody, Biotin conjugated
CSB-PA542165LD01ROH-02 100 µg

Intermediate capsid protein VP6 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TNFSF9 Protein (N-human IgG1-Fc, Rat)
P529218 100 µg

TNFSF9 Protein (N-human IgG1-Fc, Rat)

Sign In for Pricing
View Details
Quick Step Rat Chorionic Gonadotrophin beta, beta-CG ELISA Kit
QS0163Ra-01 48 Tests

Quick Step Rat Chorionic Gonadotrophin beta, beta-CG ELISA Kit

Sign In for Pricing
View Details
Quick Step Rat Chorionic Gonadotrophin beta, beta-CG ELISA Kit
QS0163Ra-02 96 Tests

Quick Step Rat Chorionic Gonadotrophin beta, beta-CG ELISA Kit

Sign In for Pricing
View Details