Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP41 Peptide - C-terminal region

USP41 Peptide - C-terminal region

Product Specifications

UniProt

Q3LFD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP41 Rabbit Polyclonal Antibody (orb327143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynamin 2 (DNM2) Human Gene Knockout Kit (CRISPR)
KN208525RB 1 Kit

Dynamin 2 (DNM2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human MAA/GSTZ1 Protein (His Tag)
PKSH032732-01 10 µg

Recombinant Human MAA/GSTZ1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human MAA/GSTZ1 Protein (His Tag)
PKSH032732-02 50 µg

Recombinant Human MAA/GSTZ1 Protein (His Tag)

Sign In for Pricing
View Details
CDC2 (Ab-15) Antibody
8B7036-AAT 50 µg

CDC2 (Ab-15) Antibody

Sign In for Pricing
View Details
Calcium Dobesilate
TRC-C145108-50MG 50 mg

Calcium Dobesilate

Sign In for Pricing
View Details
FXR1 Recombinant Rabbit Monoclonal Antibody [PSH01-35]
HA721669 100 µL

FXR1 Recombinant Rabbit Monoclonal Antibody [PSH01-35]

Sign In for Pricing
View Details