Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nr2c1 Peptide - middle region

Nr2c1 Peptide - middle region

Product Specifications

UniProt

Q505F1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nr2c1 Rabbit Polyclonal Antibody (orb576458) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSTPGKVFLTTPDAAGVNQLFFTSPDLSAPHLQLLTEKSPDQGPNKVFDL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IQCF1 Rabbit Polyclonal Antibody (HRP)
orb2108501 100 µL

IQCF1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
ZFP62 siRNA (Human)
orb1849792-01 15 nmol

ZFP62 siRNA (Human)

Sign In for Pricing
View Details
ZFP62 siRNA (Human)
orb1849792-02 30 nmol

ZFP62 siRNA (Human)

Sign In for Pricing
View Details
KLF13 Rabbit pAb, PerCP-Cy7 conjugated
orb2850725 100 µL

KLF13 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Bag4 3'UTR GFP Stable Cell Line
TU251209 1.0 mL

Bag4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
REV1 ORF Vector (Human) (pORF)
ORF014272 1.0 µg DNA

REV1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details