Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IQCF1 Rabbit Polyclonal Antibody (HRP)

IQCF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ27508, MGC39725

UniProt

Q8N6M8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IQCF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ATKIKAWWRGTLVRRALLHAALSACIIQCWWRLILSKILKKRRQAALEAF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_689610

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AKR7A2 Rabbit Polyclonal Antibody (HRP)
orb482694 100 µL

AKR7A2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
UBA6, CT (UBA6, MOP4, UBE1L2, Ubiquitin-like modifier-activating enzyme 6, Monocyte protein 4, Ubiquitin-activating enzyme E1-like protein 2) (MaxLight 750)
MBS6360550-01 0.1 mL

UBA6, CT (UBA6, MOP4, UBE1L2, Ubiquitin-like modifier-activating enzyme 6, Monocyte protein 4, Ubiquitin-activating enzyme E1-like protein 2) (MaxLight 750)

Sign In for Pricing
View Details
UBA6, CT (UBA6, MOP4, UBE1L2, Ubiquitin-like modifier-activating enzyme 6, Monocyte protein 4, Ubiquitin-activating enzyme E1-like protein 2) (MaxLight 750)
MBS6360550-02 5x 0.1 mL

UBA6, CT (UBA6, MOP4, UBE1L2, Ubiquitin-like modifier-activating enzyme 6, Monocyte protein 4, Ubiquitin-activating enzyme E1-like protein 2) (MaxLight 750)

Sign In for Pricing
View Details
IQGAP1 Rabbit Polyclonal Antibody
orb1544826-01 50 μL

IQGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IQGAP1 Rabbit Polyclonal Antibody
orb1544826-02 100 µL

IQGAP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRIM59 Protein Vector (Rat) (pPM-C-HA)
PV313000 500 ng

TRIM59 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details