OSBP2 Peptide - N-terminal region
OSBP2 Peptide - N-terminal region
Product Specifications
UniProt
Q8NA37
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OSBP2 Rabbit Polyclonal Antibody (orb325031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YEQEQRVHLEETIEQLAKQHNSLERAFHSAPGRPANPSKSFIEGSLLTPK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#30107-T 1 Kit
CellBrite® Steady 550 Membrane Staining Kit, 100 Labelings
Sign In for Pricing
View Details 
BNUB1388-500 1x 500 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), 0.2mg/mL
Sign In for Pricing
View Details 
TA363624 100 µL
IQ motif containing B1 (IQCB1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 