Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAP Peptide - C-terminal region

FAP Peptide - C-terminal region

Product Specifications

Product Name Alternative

DPPIV, FAPA

UniProt

Q12884

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAP Rabbit Polyclonal Antibody (orb579794) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004451

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SORBS2 Rabbit Polyclonal Antibody
TA362774 100 µL

SORBS2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human INO80 activation kit by CRISPRa
GA110198 1 Kit

Human INO80 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse 4-1BB/TNFRSF9 Protein (aa 24-187, Fc Tag)
PKSM041199-01 10 µg

Recombinant Mouse 4-1BB/TNFRSF9 Protein (aa 24-187, Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse 4-1BB/TNFRSF9 Protein (aa 24-187, Fc Tag)
PKSM041199-02 50 µg

Recombinant Mouse 4-1BB/TNFRSF9 Protein (aa 24-187, Fc Tag)

Sign In for Pricing
View Details
REC8 Human Gene Knockout Kit (CRISPR)
KN400132 1 Kit

REC8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
AKT3 Human Gene Knockout Kit (CRISPR)
KN221051BN 1 Kit

AKT3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details