BAZ2B Peptide - middle region
BAZ2B Peptide - middle region
Product Specifications
Product Name Alternative
WALp4
UniProt
Q9UIF8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BAZ2B Rabbit Polyclonal Antibody (orb324775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001276904.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSTTASSSMGQTKSTSSGGGNRKCNQEQSKNQPLDARVDKIKDKKPRKKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15192372 1 Vial
Lentiviral mouse Mtmr10 shRNA (UAS) - Lentiviral mouse Mtmr10 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
126026-ML490 100 µL
DSC2 (Desmocollin-2, Cadherin Family Member 2, Desmocollin-3, Desmosomal Glycoprotein II, Desmosomal Glycoprotein III, CDHF2, DSC3) (MaxLight 490)
Sign In for Pricing
View Details