Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM5 Peptide - N-terminal region

PRDM5 Peptide - N-terminal region

Product Specifications

UniProt

Q9NQX1

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRDM5 Rabbit Polyclonal Antibody (orb577086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEVRGSKGEVLYI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYVN1 Protein Vector (Human) (pPM-C-HA)
46016021 500 ng

SYVN1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Vmn2r117 (NM_001104581) Mouse Tagged ORF Clone
MG222747 10 µg

Vmn2r117 (NM_001104581) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CTGLF11P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV759400 1.0 µg DNA

CTGLF11P Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Pig Pleiotrophin (PTN) ELISA Kit
abx516336 96 Well

Pig Pleiotrophin (PTN) ELISA Kit

Sign In for Pricing
View Details
PI4Kβ/PKG-IN-1
HY-174130 1 Each

PI4Kβ/PKG-IN-1

Sign In for Pricing
View Details
CDYL2 Protein Lysate (Human) with C-Ha Tag
15799031 100 µg

CDYL2 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details