Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP62 Peptide - middle region

NUP62 Peptide - middle region

Product Specifications

Product Name Alternative

IBSN, SNDI, p62

UniProt

P37198

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUP62 Rabbit Polyclonal Antibody (orb331391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_714941

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TAPPGPGAAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS802658 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PIP5K1 beta (PIP5K1B) Human Gene Knockout Kit (CRISPR)
KN423713 1 Kit

PIP5K1 beta (PIP5K1B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD200R1L/CD200R2/CD200RLa Protein (His Tag)
PKSH031061 100 µg

Recombinant Human CD200R1L/CD200R2/CD200RLa Protein (His Tag)

Sign In for Pricing
View Details
EGFR pThr693 Rabbit Polyclonal Antibody
AP02462PU-N 100 µL

EGFR pThr693 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASC1 Rabbit Polyclonal Antibody
HA500460 100 µL

ASC1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-31 Mouse Monoclonal Antibody [B7-B0]
M1305-3 100 µL

IL-31 Mouse Monoclonal Antibody [B7-B0]

Sign In for Pricing
View Details