OR4F6 Peptide - C-terminal region
OR4F6 Peptide - C-terminal region
Product Specifications
Product Name Alternative
OR15-15, OR4F12
UniProt
Q8NGB9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR4F6 Rabbit Polyclonal Antibody (orb587598) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005326
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FISLASFLILIISYIFILVTVQKKSSGGIFKAFSMLSAHVIVVVLVFGPL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
23398116 3x 1.0 µg
Hist2h3c2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details 
MBS616068-01 0.1 mL
WASP, N-, non-phosphorylated (Ser-484/Ser-485) (WAS, THC, IMD2, WASP, Eczema-thrombocytopenia)
Sign In for Pricing
View Details MBS616068-02 5x 0.1 mL
WASP, N-, non-phosphorylated (Ser-484/Ser-485) (WAS, THC, IMD2, WASP, Eczema-thrombocytopenia)
Sign In for Pricing
View Details 