Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLL3 Peptide - C-terminal region

DLL3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SCDO1

UniProt

Q9NYJ7

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLL3 Rabbit Polyclonal Antibody (orb580010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_982353

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Hexyl-1-decanol
TRC-H295710-50G 50 g

2-Hexyl-1-decanol

Sign In for Pricing
View Details
Recombinant Human Annexin A8/ANXA8 Protein
PKSH032078-01 10 µg

Recombinant Human Annexin A8/ANXA8 Protein

Sign In for Pricing
View Details
Recombinant Human Annexin A8/ANXA8 Protein
PKSH032078-02 50 µg

Recombinant Human Annexin A8/ANXA8 Protein

Sign In for Pricing
View Details
2-Hydroxycyclopent-2-en-1-one
TRC-H954073-500MG 500 mg

2-Hydroxycyclopent-2-en-1-one

Sign In for Pricing
View Details
Mouse Gdpd3 activation kit by CRISPRa
GA207873 1 Kit

Mouse Gdpd3 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Cecum
CS805268 5x 5 µm

Tissue FFPE Sections, Cecum

Sign In for Pricing
View Details