Gtf2h2 Peptide - N-terminal region
Gtf2h2 Peptide - N-terminal region
Product Specifications
UniProt
Q8C5I2
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GTF2H2 Rabbit Polyclonal Antibody (orb581098) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-F248660-1MG 1 mg
Fenofibric Acid Acyl-Beta-D-glucuronide (~90%)
Sign In for Pricing
View Details ![Crk p38 Recombinant Rabbit Monoclonal Antibody [JE38-60]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea8232c/imageurl/ha722453.webp)
HA722453 100 µL
Crk p38 Recombinant Rabbit Monoclonal Antibody [JE38-60]
Sign In for Pricing
View Details 
GM-203-20 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 HP6014, 20nm
Sign In for Pricing
View Details 
BNC401924-100 1x 100 µL
P53 Tumor Suppressor Protein (PCRP-TP53-2A10), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 