Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULIN Peptide - C-terminal region

OTULIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

GUM, AIPDS, FAM105B

UniProt

Q96BN8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTULIN Rabbit Polyclonal Antibody (orb587398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612357

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRAIELYNDKEKGKEVPFFSVLLFARDTSNDPGQLLRNHLNQVGHTGGLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARGFX antibody
70R-8696 100 µL

ARGFX antibody

Sign In for Pricing
View Details
Human EMC10 Protein Lysate
MBS8411060-01 0.02 mg

Human EMC10 Protein Lysate

Sign In for Pricing
View Details
Human EMC10 Protein Lysate
MBS8411060-02 5x 0.02 mg

Human EMC10 Protein Lysate

Sign In for Pricing
View Details
Rabbit Anti-MCP1 Antibody (MOFY-0722-FY252)
MOFY-0722-FY252 Each

Rabbit Anti-MCP1 Antibody (MOFY-0722-FY252)

Sign In for Pricing
View Details
Rabbit Polyclonal DRIL1 Antibody [DyLight 594]
NBP2-98981DL594 0.1 mL

Rabbit Polyclonal DRIL1 Antibody [DyLight 594]

Sign In for Pricing
View Details
LASSBio-1985
HY-170963 1 Each

LASSBio-1985

Sign In for Pricing
View Details