Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERICH6B Peptide - C-terminal region

ERICH6B Peptide - C-terminal region

Product Specifications

Product Name Alternative

FAM194B

UniProt

Q5W0A0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ERICH6B Rabbit Polyclonal Antibody (orb587415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKKNYEKFKETILRIKRRREAQKLTEMTSFTFHLMSKPTPEKPETEEIQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATC1 Antibody, HRP conjugated
A46844-50UG 50 µg

NFATC1 Antibody, HRP conjugated

Sign In for Pricing
View Details
TMEM125 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV628413 1.0 µg DNA

TMEM125 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mmu-miR-99a-5p miRNA Agomir
orb1918959-01 5 nmol

Mmu-miR-99a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-99a-5p miRNA Agomir
orb1918959-02 10 nmol

Mmu-miR-99a-5p miRNA Agomir

Sign In for Pricing
View Details
Mmu-miR-99a-5p miRNA Agomir
orb1918959-03 20 nmol

Mmu-miR-99a-5p miRNA Agomir

Sign In for Pricing
View Details
ALG8 Peptide - middle region
orb2001347 100 µg

ALG8 Peptide - middle region

Sign In for Pricing
View Details